PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002213
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ZF-HD
Protein Properties Length: 286aa    MW: 31402.2 Da    PI: 8.4115
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58684083PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-47829PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.33.1e-3265117457
  ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                   rY+eClkNhAa++Gg+ +DGCgEfmps g++gt +alkCaAC+CHRnFHR+e 
    Lsa002213  65 PRYRECLKNHAANIGGNITDGCGEFMPS-GDDGTLEALKCAACNCHRNFHRKEY 117
                  69*************************9.999********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015667.4E-3066116IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-2166116IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.7E-2966116IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.167116IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.69E-18212275IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-30213275IPR009057Homeodomain-like
TIGRFAMsTIGR015652.6E-28214270IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MALSGSEKEI GMQTSSPYNN NHLIRESSSE TVDHGLDPDR FPGTGASVTP ISVGSKLLKS  60
PLQMPRYREC LKNHAANIGG NITDGCGEFM PSGDDGTLEA LKCAACNCHR NFHRKEYPTT  120
SPAVGPFLQL PPPLPSPSPS PSFHHHHHHH RTPPAISLHH NHNHHHHPNW ASSINAPPVK  180
MAFAGSVGGA ATESSSEELN FTAGAVAPPY GVAKKRFRTK FTQDQKEKML EFAEKVGWRI  240
PREDDPEVQR FCAEVGVKRQ VLKVWMHNNK ATSGKKLLQD SNESIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-252152701873ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.13e-81PREDICTED: zinc-finger homeodomain protein 5
TrEMBLA0A118JZ111e-171A0A118JZ11_CYNCS; Homeodomain-like protein
STRINGPGSC0003DMT4000095814e-75(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-57homeobox protein 31